CLEC10A, 61-292aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
CLEC10A, also known as C-type lectin domain family 10 member A isoform 2, is a C-type lectin superfamily member 14. It is expressed on immature myeloid dendritic cells and alternatively activated macrophages. This protein roles in regulating adaptive and innate immune responses. Also, it binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine, linked to serine or threonine. Recombinant human CLEC10A, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01637
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 27.3kDa (241aa), 28-40kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESHHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4).
Other Names C-type lectin domain family 10 member A isoform 2, CLEC10A, CD301, CLECSF13, CLECSF14, HML, HML2, MGL
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap