Home / Products / proteins / CKMT2, 40-419aa, Human, His tag, E.coli

CKMT2, 40-419aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CKMT2, as known as SMTCK, belongs to the ATP:guanido phosphotransferase family. SMTCK is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. This enzyme is reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate).
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01632
Size 100 µg
Host E.coli
Accession
Molecular Weight 46.1kDa (405aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMEVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer, pH8.0, 10% glycerol, 1mM DTT, 100mM NaCl
Other Names Creatine kinase S-type, mitochondrial, SMTCK
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap