CKB, 1-381aa, Human, E.coli

Categories: [Proteins / Peptides]
CKB, also known as Creatine Kinase B-type, is encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. Recombinant human CKB, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $397
  • Buy 5 for $377.15 each and save 5%
  • Buy 21 for $357.3 each and save 10%
  • Buy 31 for $337.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01629
Size 50 µg
Host E.coli
Accession
Molecular Weight 42.6kDa (381aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-Hcl Buffer (pH 8.0) containing 10% glycerol, 1mM DTT.
Other Names Creatine Kinase B-type, B-CK, BCK, CKBB, HEL-211, HEL-S-29, B CK, BB-CK, Brain creatine kinase, Ckb, Creatine kinase B, Creatine kinase B chain.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap