Home / Products / proteins / CIRBP, 1-172aa, Human, His tag, E.coli

CIRBP, 1-172aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Cold inducible RNA-binding protein, also known as CIRBP, plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. It is localizes to the nucleus and contains one RRM (RNA recognition motif) domain.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01626
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.8 kDa (192aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay )
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 50% glycerol, 0.2M NaCl.
Other Names Cold inducible RNA-binding protein, CIRP, A18HNRNP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap