Ciliary neurotrophic factor, 1-200aa, Rat, His tag, E.coli

Categories: [Proteins / Peptides]
CNTF also known as ciliary neurotrphic factor is a survival factor for various neuronal cell types. CNTF is highly conserved across species and exhibits cross-species bioactivity. CNTF is a 25 kDa polypeptide that was originally isolated as a target-derived survival factor of parasympathetic ciliary ganglion neurons. Binding of CNTF to CNTF receptor triggers heterodimerization of gp130 and LIFR, forming an active trimeric receptor complex and activates the downstream signaling pathway. Recombinant rat CNTF, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $402
  • Buy 5 for $381.9 each and save 5%
  • Buy 21 for $361.8 each and save 10%
  • Buy 31 for $341.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01624
Size 50 µg
Host E.coli
Accession
Molecular Weight 25.2 kDa (223aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate buffered saline (pH 7.4) containing 10% glycerol.
Other Names
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap