CHRNA6, 26-239aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
Cholinergic receptor, nicotinic, alpha 6, also known as CHRNA6, belongs to the nicotinic acetylcholine receptors (nAChRs) family. nAChRs are heteropentameric ligand-gated ion channels resulting from the assembly of alpha and beta protein subunits. This ion channel is gated by the binding of acetylcholine to the assembled receptor. Alpha 6 is often found associated with beta 3, beta 2, and alpha 4 subunits. CHRNA6 receptors have a relatively selective localization to the nigrostriatal pathway where they function to mediate dopamine release. Recombinant human CHRNA6 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01617
Size 100 µg
Host E.coli
Accession
Molecular Weight 29.3 kDa (250aa)
AP_Mol_Weight
Tag N-6His
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names Cholinergic receptor, nicotinic, alpha, CHNRA6
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap