CHRNA3, 32-240aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CHRNA3 also known as neuronal acetylcholine receptor subunit alpha-3 isoform 1 is a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. CHRNA3 is a ligand-gated ion channel that likely plays a role in neurotransmission. CHRNA3 have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcript variants have been described. Recombinant human CHRNA3 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01616
Size 100 µg
Host E.coli
Accession
Molecular Weight 27kDa (232aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSSEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
Purity > 95% by HPLC
Concentration 1mg/ml (determined by assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH8.0) containing 10% glycerol
Other Names Neuronal acetylcholine receptor subunit alpha-3 isoform 1, LNCR2, NACHRA3, PAOD2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap