Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP01610 |
Size | 10 µg |
Host | E.coli |
Accession | |
Molecular Weight | 27 kDa (243aa) confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | MGSSHHHHHHSSGLVPRGSHMGSHMNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS |
Purity | > 95% by HPLC |
Concentration | 0.25 mg/ml |
Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 30% glycerol |
Other Names | Charged multivesicular body protein 5, C9orf83, CGI-34, HSPC177, PNAS-2, SNF7DC2, Vps60. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap