Home / Products / proteins / CHMP2A, 1-222 aa, Human, His-tagged, Recombinant, E.coli

CHMP2A, 1-222 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
CHMP2A, also known as chromatin modifying protein 2A, belongs to the SNF7 family and it is component of the ESCRT III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01607
Size 100 µg
Host E.coli
Accession
Molecular Weight 27.2 kDa (242aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.1 M NaCl 1mM DTT, and 30% glycerol
Other Names Chromatin modifying protein 2A, BC-2, BC2, CHMP2, VPS2, VPS2A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap