CHI3L1, 1-383aa Human, His tag, CHO

Categories: [Proteins / Peptides]
Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. CHI3L1 is a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. This protein is thought to play a role in the process of inflammation and tissue remodeling. Recombinant human CHI3L1 protein was expressed with C-terminal myc-His-tag in CHO(chinese hamster ovary) cells using mammalian expression system and purified by using conventional chromatography techniques.
List Price: $195
  • Buy 5 for $185.25 each and save 5%
  • Buy 21 for $175.5 each and save 10%
  • Buy 31 for $165.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01603
Size 10 µg
Host
Accession
Molecular Weight 45.5 kDa(408aa)
AP_Mol_Weight
Tag N-6His
Sequences MGVKASQTGFVVLVLLQCCSAYKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISGPGIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAATKLGPEQKLISEEDLNSAVDHHHHHH
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. in Phosphate-Buffered Saline (pH 7.4)
Other Names Chitinase 3-like 1, GP39, ASRT7, YKL40, YYL-40, HC-gp39, HCGP-3P
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap