Home / Products / proteins / CETN2, 1-172aa, Human, His tag, E.coli

CETN2, 1-172aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CETN2, also called caltractin, belongs to a family of calcium-binding proteins and is a structural component of the centrosome. This protein plays a role in nucleotide excision repair via association with xeroderma pigmentosum group C protein, suggesting possible coupling of cell division and nucleotide excision repair.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01586
Size 50 μg
Host E.coli
Accession
Molecular Weight 21.9 kDa (192aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.1M NaCl, 1mM DTT
Other Names Caltractin, CALT, CEN2, Centrin-2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap