CEBP-α, (bZIPregion, residues 270-358, His-tag, Human)

Categories: [Proteins / Peptides]
CCAAT/enhancer binding protein(C/EBP) α is a family of transcription factors that all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP family consist of several related proteins, C/EBP α, β,γ,δ, that form homodimers and that form heterodimers with each other. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein; a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. C/EBPs differ significantly in their physiological functions and in their downstream target genes. For example, mice lacking C/EBPα die shortly after birth due to severe hypoglycemia and the absence of glycogen storage in liver, whereas knockout of C/EBPβ causes defects in female reproduction. The bZip region of CEBP-α (residues 270-358) was produced in E.coli and purified by ion-exchange chromatography and FPLC gel-filtration chromatography.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01573
Size 100 µg
Host
Accession
Molecular Weight 14.5kDa (126aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 0.1 M NaCl, 5 mM β-Mercaptoethanol
Other Names CCAAT/enhancer binding protein α, CEBPA
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap