CEACAM6, 35-320aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
CEACAM6, also known as Carcinoembryonic antigen-related cell adhesion molecule 6, belongs to the human carcino-embryonic antigen (CEA) family. It is a member of glycosylphosphatidylinositol-linked immunoglobulin superfamily that is implicated in a variety of human cancers. It is associated with the progression of pancreatic cancer. Recombinant human CEACAM6, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01571
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 32.6kDa (297aa), 40-57KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences ADPEFKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGHHHHHH
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Carcinoembryonic antigen-related cell adhesion molecule 6, CEACAM6, CD66c, CEAL, NCAm, Carcinoembryonic antigen related cell adhesion molecule 6.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap