Home / Products / proteins / CDC26, 1-85aa, Human, His tag, E.coli

CDC26, 1-85aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CDC26, also known as ANAPC12, APC12, belongs to the CDC26 family which orchestrates progression through mitosis by decorating cell-cycle regulators with ubiquitin chains. This protein is component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01545
Size 100 µg
Host E.coli
Accession
Molecular Weight 11.9 kDa (105aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 40% glycerol, 0.1M NaCl
Other Names Anaphase-promoting complex subunit CDC26, ANAPC12, APC12
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap