CD9, 112-195aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CD9, also known as CD9 antigen, is a protein that in humans is encoded by the CD9 gene. CD9 is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is found on the surface of exosomes. It can modulate cell adhesion and migration and also trigger platelet activation and aggregation. In addition, the protein appears to promote muscle cell fusion and support myotube maintenance. This protein also seems to be a key part in the egg-sperm fusion during mammalian fertilization, as CD9 knocked-out mice gametes don't undergo fusion. Recombinant human CD9, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01541
Size 100 µg
Host E.coli
Accession
Molecular Weight 12kDa (107aa) confirmed by MALDI-TOF.
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate buffer saline (pH 7.4) containing 20% glycerol, 1mM DTT.
Other Names CD9 antigen, BTCC-1, DRAP-27, MIC3, MRP-1, TSPAN-29, TSPAN29
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap