CD79B, 29-159aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CD79B, also known as Igb and B29, is a 36 kDa transmembrane glycoprotein in the immunoglobulin superfamily. Heterodimers of CD79A and CD79B associate with a membrane bound immunoglobulin on the B cell surface to form the B cell antigen receptor complex(BCR).
List Price: $278
  • Buy 5 for $264.1 each and save 5%
  • Buy 21 for $250.2 each and save 10%
  • Buy 31 for $236.3 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01534
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.7 kDa (155aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2M UREA, 10% glycerol
Other Names CD79b molecule, immunoglobulin-associated beta, AGM6, B29, IGB
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap