CD79B, 29-159aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
CD79B, as known as B-cell antigen receptor complex-associated protein beta chain isoform 1, is B-cell-specific glycoprotein B29. It is a single-pass type 1 membrane protein containing one Ig-like V-type domain and one ITAM domain. This protein is required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR). CD79A and B proteins are required for BCR-meditated signaling and consequently for the development and activation of B lineage cells. Recombinant human CD79B, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $278
  • Buy 5 for $264.1 each and save 5%
  • Buy 21 for $250.2 each and save 10%
  • Buy 31 for $236.3 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01535
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 16.3kDa (140aa)18-28kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names B-cell antigen receptor complex-associated protein beta chain isoform 1, CD79B, AGM6, B29, IGB
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap