CD74, 73-232aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
CD74, also known as HLA class II histocompatibility antigen gamma chain or HLA-DR antigens-associated invariant chain or CD74 (Cluster of Differentiation 74). The nascent MHC class II protein in the rough ER has its peptide-binding cleft blocked by the invariant chain (Ii; a trimer) to prevent it from binding cellular peptides or peptides from the endogenous pathway. The invariant chain also facilitates MHC class II's export from the ER in a vesicle. The signal for endosomal targeting resides in the cytoplasmic tail of the invariant chain. This fuses with a lateendosome containing the endocytosed, degraded proteins. It is then cleaved by cathepsin S (cathepsin L in cortical thymic epithelial cells), leaving only a small fragment calle CLIP which blocks peptide binding until HLA-DM binds to MHC II, releasing CLIP and allowing other peptides to bind. The stable MHC class-II is then presented on the cell surface. Recombinant human CD74, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01533
Size 50 µg
Host Insect cell
Accession
Molecular Weight 19.05kDa (166aa) 18-28kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPMHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by absorbance at 280nm)
Formulation Liquid. In phosphate buffered saline (pH7.4) containing 10% glycerol.
Other Names HLA class II histocompatibility antigen gamma chain isoform b, DHLAG, HLADG, Ia-GAMMA II
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap