CD74, 73-232aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
HLA class II histocompatibility antigen gamma chain isoform b, also known as CD74, is a transmembrane protein which, on antigen presenting cells, is the invariant chain that chaperones MHC class II dimers from the endoplasmic reticulum to the cell surface. CD74 is expressed by cells of both T lymphocyte and B lymphocyte lineages. It is upregulated in several cancers and is also expressed by nonimmune cells during inflammation. Recombinant human CD74 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01532
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.6kDa (183aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 30% glycerol, 1mM DTT
Other Names HLA class II histocompatibility antigen gamma chain isoform b, DHLAG, HLADG, Ia-GAMMA, II
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap