CD70, 39-193aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
CD70, also known as CD70 antigen, is a transmembrane protein in the TNF receptor superfamily. It functions as a co-stimulatory molecule that supports lymphocyte activation and survival. This protein binds to the transmembrane glycoprotein CD27 ligand/CD70 which is expressed on activated B cells, activated T cells, and dendritic cells. Binding of CD70 to its receptor CD27 induces in priming, effector functions, differentiation and memory formation of T cell activation, and thus is proliferation of co-stimulated T cells, as well as the generation of cytolytic T cells. Recombinant human CD70, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01530
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 18.2kDa (164aa)
AP_Mol_Weight
Tag N-6His
Sequences ADPQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRPHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names CD70 antigen, CD27L, CD27LG, TNFSF7
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap