CD7, 26-180aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
T-cell antigen CD7, also known as CD7, is a type I transmembrane glycoprotein that is expressed on pluripotential hemapoietic cells, most human thymocytes and some peripheral blood T cells. The CD7 molecule is absent in a subset of human T cells under certain physiologic conditions. Thus an increase in CD7 negative T cells can be seen in some inflammatory skin disease. Recombinant human CD7 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01528
Size 100 µg
Host E.coli
Accession
Molecular Weight 18.8 kDa (178aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names T-cell antigen CD7, GP40, LEU-9, Tp40, TP41
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap