CD69, 62-199aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
CD69, also known as early activation antigen CD69, is a type 2 transmembrane glycoprotein in the C-type lectin family. Also, CD69 is a very early activation Ag of T lymphocytes. It is involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. This protein plays a role in the pathogenesis of allergen induced eosinophilic airway inflammation and responsiveness. Recombinant human CD69, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $276
  • Buy 5 for $262.2 each and save 5%
  • Buy 21 for $248.4 each and save 10%
  • Buy 31 for $234.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01527
Size 50 µg
Host Insect cell
Accession
Molecular Weight 17.0kDa (147aa), 18-28KDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences ADPSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYKHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names CD69, AIM, BL-AC/P26, CLEC2C, EA1, GP32/28, MLR-3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap