Home / Products / proteins / CD68, 22-319aa, Human, His-tag, Baculovirus

CD68, 22-319aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
CD68, also known as macrosialin, is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. It is expressed on monocytes/macrophages. It is found in cytoplasmic granules and in the cytoplasm of various non-hematopoietic tissues including liver and kidney tubules and glomeruli. CD68 is also found on the surface of macrophages, monocytes, neutrophils, basophils and large lymphocytes. Recombinant human CD68 protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01526
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 32.6kDa (307aa), 57-70KDa (SDS–PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSHHHHHH
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Macrosialin isoform A, CD68, GP110, LAMP4, SCARD1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap