CD5, 25-372aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
CD5, as known as T-cell surface glycoprotein CD5, is a transmembrane glycoprotein in the scavenger receptor superfamily. This protein was found expressed in small lymphocytic lymphoma, hairy cell leukemia and mantle cell lymphoma cells. CD5 expression on developing thymocytes is positively regulated by signaling through the T cell antigen receptor and is up-regulated peripheral CD4+ cell. Also, its Signaling inhibits the generation of regulatory T cells but promotes the development of Th17 cells. Recombinant human CD5, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01522
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 40.0kDa (359aa)40-57kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPEFRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names T-cell surface glycoprotein CD5, CD5, LEU1, T1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap