CD40 ligand, 112-260aa, Mouse, His tag, Insect cell

Categories: [Proteins / Peptides]
CD40LG, also known as CD40 ligand, belongs to the tumor necrosis factor family. This protein binds to TNFRSF5. CD40LG mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. CD40 ligand dysregulation on T cells and antigen presenting cells contributes to the immune deficiency associated with HIV infection and AIDS. Recombinant mouse CD40LG, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $232
  • Buy 5 for $220.4 each and save 5%
  • Buy 21 for $208.8 each and save 10%
  • Buy 31 for $197.2 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01514
Size 10 µg
Host Insect cell
Accession
Molecular Weight 17.2kDa (155aa) 18-28KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKLHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names CD40lg, CD154, CD40-L, Cd40l, gp39, HIGM1, IGM, IMD3, Ly-62, Ly62, T-BAM, Tnfsf5, TRAP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap