CD3G, 23-116aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
CD3G, also known as T-cell surface glycoprotein CD3 gamma chain, is associated on the T cell surface with a complex of protein called CD3. The protein is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal transduction pathways. Defects in this gene are associated with T cell immunodeficiency. Recombinant human CD3G protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $309
  • Buy 5 for $293.55 each and save 5%
  • Buy 21 for $278.1 each and save 10%
  • Buy 31 for $262.65 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01511
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 11.8kDa (103aa) 13.5-18KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISHHHHHH
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names T-cell surface glycoprotein CD3 gamma chain, CD3G, CD3-GAMMA, IMD17, T3G
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap