CD320, 31-229aa, Human, hIgG-His-tag, Baculovirus

Categories: [Proteins / Peptides]
CD320, also known as CD320 antigen isoform 1, belongs to the low-density lipoprotein receptor family, with 2 low-density lipoprotein receptor type A domains separated by a complement-like cysteine-rich region. It binds TC- cobalamin (Cbl) and internalizes the complex by endocytosis. It is known to enhance proliferation of germinal center (GC) B cells and follicular dendritic cells. It augments the proliferation of PC precursors generated by IL-10. It collaborates with CD44 in supporting lymphomagenesis by a Burkitt lymphoma cell line, L3055. Recombinant human CD320, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $276
  • Buy 5 for $262.2 each and save 5%
  • Buy 21 for $248.4 each and save 10%
  • Buy 31 for $234.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01503
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 47.4kDa (438aa), 57-70kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences LEAAASPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names CD320 antigen isoform 1, CD320, 8D6, 8D6A, TCBLR
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap