Home / Products / proteins / CD300E, 18-173aa, Human, His tag, E.coli

CD300E, 18-173aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CMRF35-like molecule 2 precursor, also known as CD300E, is a 205 amino acid single-pass type I membrane protein that contains one Ig-like V-type (immunoglobulin-like) domain and belongs to the CD300 family. Interacting with DAP12, CD300E most likely functions as an activating receptor. CD300E is present on the surface of mature hematopoietic cells of the monocyte and myeloid lineages. Recombinant human CD300E protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01502
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.9kDa (179aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSLKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFLVVNPGRNLSTGEVLTQNSGFRLSSPH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0)
Other Names CMRF35-like molecule 2 precursor, CD300LE, CLM-2, CLM2, CMRF35-A5, IREM-2, IREM2, PIgR-2, PIgR2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap