ASPA, 1-313aa, Human, E.coli

Categories: [Proteins / Peptides]
ASPA also known as aspartoacylase, is expressed in liver, lung and kidney tissue, as well as in skeletal muscle and in cerebral white matter. Existing as a homodimer, ASPA functions to catalyze the deacetylation of N-acetylaspartic acid (NAA) (a protein whose hydrolysis is crucial to maintenance of intact white matter) to produce acetate and L-aspartate. Recombinant human ASPA, was expressed in E.coli and purified by conventional chromatography techniques.
List Price: $122
  • Buy 5 for $115.9 each and save 5%
  • Buy 21 for $109.8 each and save 10%
  • Buy 31 for $103.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01250
Size 5 µg
Host E.coli
Accession
Molecular Weight 35.7 kDa (313 aa)
AP_Mol_Weight
Tag
Sequences MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate buffered saline (pH 7.4) containing 10% glycerol
Other Names ACY2, ASP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap