Home / Products / proteins / ARL6, 1-186aa, Human, His tag, E.coli

ARL6, 1-186aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
ARL6, also known ADP-ribosylation factor-like protein 6, belongs to the ARF family of GTP-binding proteins. This protein is known to play essential roles in modulating membrane trafficking and cytoskeletal functions. Mutation in ARL6 causes Bardet-Biedl syndrome (BBS3).
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01229
Size 50 µg
Host E.coli
Accession
Molecular Weight 23.2 kDa (206aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.2M NaCl,5mM DTT
Other Names ADP-ribosylation factor-like protein 6, BBS3, MGC32934, RP55
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap