Home / Products / proteins / ANAPC13, 1-74aa , Human, T7 tag, E.coli

ANAPC13, 1-74aa , Human, T7 tag, E.coli

Categories: [Proteins / Peptides]
ANAPC13, also known as anaphase-promoting complex subunit 13, is component of the anaphase promoting complex, a large ubiquitin-protein ligase that controls cell cycle progression by regulating the degradation of cell cycle regulators such as B-type cyclins.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01152
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.0 kDa (89aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MASMTGGQQMGRGSHMDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 1mM DTT, 0.1M NaCl
Other Names Anaphase-promoting complex subunit 13, APC13, SWM1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap