Aldo-keto reductase family 1 member C3 isoform 1, 1-323aa, Human, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
AKR1C3 also known as Aldo-keto reductase family 1 member C3 isoform 1, is a member of the aldo-keto reductase superfamily which catalyzes the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9 alpha, 11 beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and differentiation. Recombinant human AKR1C3 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $122
  • Buy 5 for $115.9 each and save 5%
  • Buy 21 for $109.8 each and save 10%
  • Buy 31 for $103.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01129
Size 10 µg
Host E.coli
Accession
Molecular Weight 36.8kDa (323aa)
AP_Mol_Weight
Tag
Sequences MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.5) containing 0.1M NaCl, 10% glycerol, 1mM DTT
Other Names DD3, DDX, HA1753, HAKRB, HAKRe, hluPGFS, HSD17B5, PGFS
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap