AIF1L, 1-150aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
AIF1L, also known as allograft inflammatory factor 1-like, is a cytoplasmic, cytokine-induced, calciumbinding protein first discovered in rat cardiac allografts with chronic rejection. This protein is a marker of human microglia and is expressed by macrophages in injured skeletal muscle and regulates reduced proliferation and differentiation of satellite cells.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01094
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.2 kDa (170aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT
Other Names Allograft inflammatory factor 1-like isoform 1, C9orf58, FLJ12783, IBA2, MGC29466.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap