Home / Products / proteins / ABRACL, 1-81aa, Human, His tag, E.coli

ABRACL, 1-81aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Costars family protein ABRACL, also known as ABRACL, belongs to a new family of low molecular weight proteins, which is only present in eukaryotes, and is absent in fungi. Recombinant human ABRACL protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01021
Size 100 µg
Host E.coli
Accession
Molecular Weight 11.4 kDa (104aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 20% glycerol
Other Names Costars family protein ABRACL, C6orf115, Costars, HSPC280, PRO2013, RP11-501K14.2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap