Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP01014 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 15.7 kDa (145aa) confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | MGSSHHHHHHSSGLVPRGSHMGSMTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC |
Purity | > 95% by HPLC |
Concentration | 1.0 mg/ml (determined by Bradford assay) |
Formulation | Liquid, In Phosphate buffered saline (pH7.4) containing 20% glycerol, 1mM DTT |
Other Names | Mth938 domain-containing protein, C11orf67, CK067, PTD015 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap