14-3-3 η, 1-246aa, Human, His tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
The 14-3-3 family of proteins plays a key regulatory role in signal transduction, checkpoint control, apoptotic and nutrient-sensing pathways. 14-3-3 proteins are highly conserved and ubiquitously expressed. There are at least seven isoforms, β, γ, ε, σ, ζ, τ and η that have been identified in mammals. The 14-3-3 eta, a subtype of the 14-3-3 family of proteins, was found in B cells, brain, cerebrospinal fluid etc. 14-3-3 eta interacts with and relocalizes the A20 zinc finger protein from the insoluble to the soluble fraction, suggesting a chaperone function. Recombinant human 14-3-3 eta, fused to His-tag at N-terminus, was expressed in E.coli and purified by conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01009
Size 100 µg
Host E.coli
Accession
Molecular Weight 30.3 kDa (266 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid in 20 mM Tris pH 8.0
Other Names Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide; YWHA1; YWHAH.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap