τ, 1-352aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MAPT, also known as TAU, is a neuronal microtubule associated protein found predominantly on axons. The function of this protein is to promote tubulin polymerisation and stabilise microtubules, but it also serves to link certain signalling pathways to the cytoskeleton. MAPT, in its hyperphosphorylated form, is the major component of paired helical filaments (PHF) and neurofibrillary lesions in Alzheimer's disease (AD) brain. Recombinant human MAPT protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques
List Price: $617
  • Buy 5 for $586.15 each and save 5%
  • Buy 21 for $555.3 each and save 10%
  • Buy 31 for $524.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01001
Size 50 µg
Host E.coli
Accession
Molecular Weight 38.9 kDa (372aa) confirmed by MALDI-TOF (Real molecular weight on SDS-PAGE will be shift up)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M Nacl, 1mM DTT, 10% glycerol
Other Names TAU, DDPAC, FTDP-17, MAPTL, MSTD, MTBT1, MTBT2, PPND, Microtubule-associated protein tau
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap